Photos of instafamous

meme_dejavu

@meme_dejavu


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19428828_1180603108718131_2848640881592893440_n.jpg

Comment from meme_dejavu:


😂 @ifunnymeme me funnymemes funny lol instagood instafamous pinkfloyd trump obama queen

10 Seconds ago

Miss Sunshine ☀

@90s_diana


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c185.0.709.709/19428854_321224998304483_6934691493617598464_n.jpg

Comment from Miss Sunshine ☀:


You don't like me? I don't care! 😜 inked inkedgirls inkedbeauty inkedwomen inkworld tatt tattoo tattooed tattoosleeve tiger tigertatoo makeup selfiequeenselfie selfienation selfieaddict instaselfie selfieoftheday me myself instafame instafamous beauty nice love lovely cute tatuajes tatuaje tinta

13 Seconds ago

💫💕Roberta Lanzilotti💕💫

@roberta_lanzilotti


https://scontent.cdninstagram.com/t51.2885-15/e35/19429594_1897158390503050_5044116966604800_n.jpg

Comment from 💫💕Roberta Lanzilotti💕💫:


goodnightbuonanottefollowinsta instafahionfallowmeinsta📷inst �instalovelikeforlikelike4like

16 Seconds ago

Rashawnda Cashawn Hargo

@rebornthroughfire


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19429457_1559017434150921_3213900057384321024_n.jpg

Comment from Rashawnda Cashawn Hargo:


Cajun fried chicken & fried oysters homecook followme foodporn istafood foodie istagood homemade instagoodness goodness tasty😋 yummy delicious foodpics goodeats instafamous instafood foods instafoodie foodgasm seasoned friedchicken chicken friedoysters frankshotsauce oysters

35 Seconds ago

Geezer Gamer Network

@geezer_gamer_network


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.45.1080.1080/19535344_197745890757021_3461272439713955840_n.jpg

Comment from Geezer Gamer Network:


Mr Nugent. . . . . . instafollowb instafollow gamer gamerguygames videogames instamurica followme follow4follow follow4like follow4followback followforfollowbackalways💯😘 instahub instafollowback instafollowers instafollow instafamous f4f follow f followforfollow followtrain follow4follow followme follow4follow follow4like follow4followback followforfollowbackalways gta gta5 gtav gtapc gtadlc gtaonline tednugent

43 Seconds ago

Jacopo Rossini

@jacopo.rossini


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19428774_237052400120632_2494821626072268800_n.jpg

Comment from Jacopo Rossini:


Cià Carletto 👋 @arco1795 💕💦 bestoftheday comment contests filter filters follow followme fun gang_family golook gramoftheday hipster ig_snapshots ig_watchers igaddict igdaily igers igersoftheday implus_daily insta insta_global instadaily instafamous instago instagood instagramhub instagrammers instalove instamood instatalent

53 Seconds ago

🇧🇷 CREW BRAZIL ©®

@crewbrazil


https://scontent.cdninstagram.com/t51.2885-15/e35/c75.0.389.389/19533761_227912494387654_2079240264093794304_n.jpg

Comment from 🇧🇷 CREW BRAZIL ©®:


Sonhe alto! ▫ O máximo que pode acontecer é você realizar um sonho à altura.▫🌍✈🔚 latamairlines latam somoslatam aviation aviationlover aviationlovers cabincrew crewlife voandoalto livingthedream instafamous instaviation flightattendant comissariodevoo fly flying gopro goproaviation onboard boarding oneworld vidadetripulante avporn avgeek airplane airplanes

53 Seconds ago

Matty McCasland

@hebevash


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c175.0.730.730/19428651_1416815038408161_4057626415380561920_n.jpg

Comment from Matty McCasland:


Nycho Cheese photography photo photographer graffiti culture foto bnw bw bnw_society black white monday losangeles newyork sandiego lasvegas sanfrancisco instagood instagram instalove instafamous instaphoto hebevash mfmattym details art slabcity artwork

1 Minutes ago

Yvonne del Castillo

@yorazzi


https://scontent.cdninstagram.com/t51.2885-15/e35/c249.0.582.582/19534136_1184247315020460_7692314954308780032_n.jpg

Comment from Yvonne del Castillo:


Mother and daughter score coach vandpolo sportsphotography sport waterpolo wasserball waterpologirl waterpoloteam standanddeliver pallanuoto poloacuatico instagood instafamous instalike instadaily motherdaughter thephotosociety swisswaterpolo yordosport yordo waterpolofamily

1 Minutes ago

>•< D E C O R B A S E D >•<

@pineapple.deco


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19429272_1414706241916243_8339010988976111616_n.jpg

Comment from >•< D E C O R B A S E D >•<:


Hey🖑 if your not following @pineapple.deco you really should. They have different decor and fashion peices. It's like a beautiful collage ! >< @pineapple.deco >< >< @pineapple.deco >< >< TAGS 🖤 decor fashion design fashionista style instafamous decoration deco like4follow like4like fashionweek trend trending fashiontrend deskdecor housedecor fashiontre easyfashion diy doityourself diydecor diyfashion kidfashion fashionblogger fallfashion fashionmen fashionstatement fashionlook fashionlove

1 Minutes ago

Carrack Vape

@carrackvape


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c180.0.720.720/19436826_1942689772674258_6952575806157619200_n.jpg

Comment from Carrack Vape:


Thank you @gshirevaper! Repost @gshirevaper ( @get_repost) ・・・ Vape mail!! Thanks to @carrackvape really good communication and speedy delivery from Canada. Can't wait to get my Deathwish Hog v3.1 and Deathtrap RDA and try out this Wire Doctor with Coolrazz 🤘💨💨🤘 vape vapelifevapefamvapecommunityva ityvapestagraminstafamousvapel vapelyfeeliquidscloudchasingej ingejuicevapersinstavapetrickl ricklyfevapetricksvapedailyvap lyvapenationcalivapersvapepics epicsvapelovevapehooligansvape thickoiljuiceco thewiredoctor

1 Minutes ago

My WCE

@my_wce


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.96.1080.1080/19535035_1453745604685180_2438232257966637056_n.jpg

Comment from My WCE:


@truemahogany❤ @my_wce❤ . 🔔Turn on post notification . Follow ------ @ig_goddesses @inked_temptations & @i.love.selfes . wce wcw florda mam mambeach atlanta f4f followforfollow followback l4l lkesforlkes followback lkes lkeforfollow followforlke recentforrecent r4r nstadaly nstamood tagsforlkes nstafamous lkeback s4s comment beautful love lt dope grls

1 Minutes ago

Instagram | INKKY ARST

@inkkyarista


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.135.1080.1080/19428865_1840013642681303_280876790845538304_n.jpg

Comment from Instagram | INKKY ARST:


Set a goal that makes you want to jump out of bed in the morning 🙌 - - - In frame : @guring_menggale

1 Minutes ago

Marina

@___me.myself.i


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.120.960.960/19436266_977672665705425_3261945902314553344_n.jpg

Comment from Marina:


Perché tu, così come sei, sei tutto ciò di cui ho bisogno. bestoftheday comment contests filter filters follow followme fun gang_family golook gramoftheday hipster ig_snapshots ig_watchers igaddict igdaily igers igersoftheday implus_daily insta insta_global instadaily instafamous instago instagood instagramhub instagrammers instalove instamood instatalent

1 Minutes ago

kanariarts

@kanariarts


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.135.1080.1080/19428679_806718396157031_8551394372984242176_n.jpg

Comment from kanariarts:


photo session with @deisidian cafe bw photowall photogram fashionista bnwblackandwhite beach hairdo fashion fashionblogger vsco vscocam look her beauty igers photooftheday NYC vscofilm instafamous pose instafashion statigram insta instabeauty cinematic film filmphotography

1 Minutes ago

WISATA ALAM SEROJA DESA TLOGO

@seroja_wonosobo


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c124.0.832.832/19425323_314511295670669_6402473031926546432_n.jpg

Comment from WISATA ALAM SEROJA DESA TLOGO:


@Regrann from @ihsan_seroja - Sedikit melihat kebawah dan menundukkan kepala akan merendahkan hati kita yang kadang angkuh dan sombong. Apa kamu lupa didunia ini kita hanyalah titik kecil di alam semesta. . . instagram InstaTags4Likes instalove instamood instagood instagrammers like follow comment shoutout photography iphoneography androidography filter filters hipster contests photo ig igaddict photooftheday insta picoftheday bestoftheday instadaily instafamous popularpage popular Lok. Wisata Alam Seroja Wonosobo

2 Minutes ago

Shaa GRANDE@Schaanazrey

@schaagrande


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19429097_643496812510011_8662879779684352000_n.jpg

Comment from Shaa GRANDE@Schaanazrey:


Still in raya mood..raya ke 4..back to kl..raya instafamous igers eid entrepreneurlife

2 Minutes ago

Rizky Iphylz Hardinata

@rizkyhar29


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19436578_718859411650749_517612008061796352_n.jpg

Comment from Rizky Iphylz Hardinata:


😘😘😍😘😍😘😘😘 cutenessoverload cuteness babygirl indonesian lightroompresets splittone lightroom like4like likeforlike instagood instafamous

2 Minutes ago

💋Makeup Artist💋 👄Beauty 👄

@mariana_kropf


https://scontent.cdninstagram.com/t51.2885-15/e35/c92.0.450.450/19436544_647557382114031_528036108437553152_n.jpg

Comment from 💋Makeup Artist💋 👄Beauty 👄:


Make de hj! 💄💋 maccosmetics instalove teamrebel instalovers instabeauty @tags4likesandroidapp instagallery instafamous instasg imagin8 life followme igaddicts instaplus bestpicture all_pixs bepopular instacool instagain latergram genginsapgan

3 Minutes ago

SubConMike_9SV is snapchat😤💨

@subconmike


https://scontent.cdninstagram.com/t51.2885-15/e35/19436909_310625989385590_1743503692767690752_n.jpg

Comment from SubConMike_9SV is snapchat😤💨:


Squonk life!!! Of course CK Squared In one and Shore Shot in the other both available @9southvapes link in my bio... 9SouthVapes DontWorry SubOmen CloudStatus BoltMob VapeCapitol ChoiceEliquid CTVC FACTS JoinTheThieves vape vapelife vapefam vapecommunity vapestagram weoutheredoe instafamous vapelyfe eliquids ejuice vapers instavape vapetricks vapedaily vapepics vapehooligans vapes vapefamous improof

3 Minutes ago

Luxury 10X

@luxury.10x


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19428856_142068966349313_8090465762747088896_n.jpg

Comment from Luxury 10X:


Follow us @luxury.10x ~ dubai strong fashiongram ferrari dxb instafamous outfit sharjah designer entrepreneur progress look benz bugatti fashiondaily amg designs ootdshare motivationmonday frame fashionlover lifestyle decorating amazingcars247 mindset

3 Minutes ago

Clarissa Lepore

@mrsclarissalepore


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.135.1080.1080/19535177_120577768547052_5186378605709492224_n.jpg

Comment from Clarissa Lepore:


W/my little cousin Giorgia. Luv u babe❤️ bestofthedaycommentfilt followmelittlemix gramofthedayig_snapshots ig_watchersigaddictigdailyiger yigersofthedayimplus_dailyinst instadailyinstafamousinstago instagoodinstagramhub instagrammersinsta loveinstamood instatalentmakeupnofilterootdp

3 Minutes ago

Ash Tré

@looove_child


https://scontent.cdninstagram.com/t51.2885-15/e35/c236.0.608.608/19428681_1542069929191076_3226187331752951808_n.jpg

Comment from Ash Tré:


No amount of filtering could fix how stupid my face looks in this picture BUT.... LOOK HOW BEAUTIFUL MY FAMILY IS! 😍 Yes, you read that right... My FAMILY. My blood. Yes I am white and privileged. And yes I will and do use that privilege to protect them against others who choose to try and use their white privilege against them. Until my dying day. MY KING AND QUEENS! 😍👑 blackandwhite multicultural family mixed mixedfamily familyovereverything inkaddict girlswithink girlswithtattoos inkstagram instafamous instafollow f4f followme tattooedmodels tattoos inkedandcurvy tattooedgirls tattooedbeauty tattooedbabes inkedmag sinwithme witch🔮 witchcraft witchywoman babeswithtattoos tattooedbabes tattooed tattooedgirlsofig tattoosofinstagram

3 Minutes ago

Sweet Shop Cakes

@sweetshopcakes


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19122309_1862240657372971_7667922911616827392_n.jpg

Comment from Sweet Shop Cakes:


School's out! Here are some sugar cookies for teachers as a thank you gift! 🍎✏️

4 Minutes ago

Naura Nadhifa Nur Fadli

@embulnya_yanda


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19429390_1386303691425383_7616576440154193920_n.jpg

Comment from Naura Nadhifa Nur Fadli:


My Lovely Family... eidmubarak lebaran2017 lebaran weareinblue bluetheme lovelyfamily instagram instagramers instagood instafamily instafamous instatag instatags instalike

4 Minutes ago

MARCO DELVECCHIO

@marcodelvec


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19429493_100784167225272_53270848739475456_n.jpg

Comment from MARCO DELVECCHIO:


S/O to the homie @ronniebunse for always taking care of the boys. Warwick8

4 Minutes ago

🍍🍯Puerto Rican baby🙏💜

@lilone_mimi


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19534680_188532085013147_6009122918888374272_n.jpg

Comment from 🍍🍯Puerto Rican baby🙏💜:


Fluffy❤️💪😘like4like instafamous curlyhair fluffy

4 Minutes ago

Amber H 💋| NEW PAGE 🤘🏽

@ambeeerrh


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19436606_312035792589152_4958271174632013824_n.jpg

Comment from Amber H 💋| NEW PAGE 🤘🏽:


Mines 💍 instafamous jackpotgaintrain uglyfollowtrain uglygaintrain helpmegain helpyallgain ilostthejuice dt followlike like4like like4follow likeforlike likeforfollow jaygainingtrain followtrain jaygainsfollowtrain 2017gainparty 2017gainpost 2017cashfollowtrain cashfollowtrain parodygaintrain openpg parodyfollowtrain openrp yungslutfollowtrain instagood rfr recentforrecent cashfollowplane jaygainplane parodyfollowtrain

4 Minutes ago

Jaylen Barron

@ourjaylen


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19429157_1372016909533508_5391559278022623232_n.jpg

Comment from Jaylen Barron:


Curly headed cutie💍 - - instafamous jackpotgaintrain uglyfollowtrain uglygaintrain helpmegain helpyallgain ilostthhejuice dt followlike like4like like4follow likeforlike likeforfollow jaysgainingtrain followtrain jaysgainfollowtrain 2016gainparty 201gainpost 2016cashfollowtrain cashfollowtrain parodygaintrain parodyfollowtrain openrp yungslutfollowtrain jaylenbarron shameless freerein @jaylenbarron

4 Minutes ago

SAVAGE SUPPS

@savage_supps


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.51.750.750/19429074_1343842685671034_6599363695803891712_n.jpg

Comment from SAVAGE SUPPS:


SHOUT OUT TO @BRYAN COLUCCI KILLER B DAY PRESENT IDEA!! BE SURE TO CHECK OUT OUR NEW FLAVOR CHERRY SAVAGE WHEY NOW AVAILABLE !!! USE CODE "NEWCUS20" AT CHECKOUT FOR 20% OFF YOUR FIRST ORDER SAVAGESUPPS.COM!!!100% pure whey isolate , undenatured, cold filtered CFM processing, 25g protein, 5.5 bcaas per serving, 0 fat 0 sugar 0 carbs 110 Cal exceptional taste and mixability dont Settle for the adverage whey try the savage whey today! Come by today!! quote of the day: "to achieve something you've never had before, you must do something you've never done before" We are open today from 9am - 8pm. Come and check out our new products! If you haven't checked us out at all yet come on down! Located at 15 John L. Dietsch blvd. North Attleboro, MA. nevergiveup neverquit motivation supplements gymlife healthyhabits instafit gymshark leangains determination fitnessjourney fitnessaddict fitnesslifestyle protein protein gainz gymtrainhard savage instaworthy instadaily protein healthyhabits progress eatclean instafamous instagood massbuilder trainharderthanme whey

5 Minutes ago

Rizky Iphylz Hardinata

@rizkyhar29


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/c0.135.1080.1080/19534532_400328480362055_4954605321260630016_n.jpg

Comment from Rizky Iphylz Hardinata:


😘😘😘😘😘 cutenessoverload cuteness babygirl indonesian lightroompresets splittone lightroom like4like likeforlike instagood instafamous

5 Minutes ago

Rich Godd | Celebrity Visuals

@richgodd


https://scontent.cdninstagram.com/t51.2885-15/s320x320/e15/19534193_126971731223075_6440718590415994880_n.jpg

Comment from Rich Godd | Celebrity Visuals:


DirectorRichGodd with that moment you been waiting for my bro @djneweranyc bday party at lamarina lamarinanyc ... video 3 of 10 this week Staring @prettylou11 @djcamilo Ps tag your friends you see in the video... I'm giving away special gifts to those who repost.... Powered by @fullyequippedent @demboyzmg bestoftheday black party white amazing like workout instafamous instasg textagram family instago igaddict awesome girls instagood director music gym water yum night instalove instagain wtf app @pnbrock

6 Minutes ago

gavin&alexa💕

@themeadowmini


https://scontent.cdninstagram.com/t51.2885-15/s320x320/sh0.08/e35/19425273_233986740446646_8582754497602781184_n.jpg

Comment from gavin&alexa💕:


🌳🌳self milled wood from a red oak in the neighborhood gavin grew up in. the flooring is finally coming together. one inch thick for some proper insulation. can not wait to see the final result!! stay tuned 🌳☀🛠

22 Hours ago